PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009605049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 684aa    MW: 78841.7 Da    PI: 7.2269
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009605049.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK56.46e-18509557351
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                     ++++ +dl+++F++++ dAA +L+v+ ++LKr CR+yGI+RWP+ k k+
  XP_009605049.1 509 DSVNYDDLKQHFNKNLSDAAESLQVSRSTLKRLCRKYGIRRWPSSKRKK 557
                     678899*************************************988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.152495580IPR003035RWP-RK domain
PfamPF020426.3E-18511557IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.601.9E-5520547IPR009057Homeodomain-like
SuperFamilySSF542777.85E-18585675No hitNo description
PROSITE profilePS5174519.598594676IPR000270PB1 domain
SMARTSM006667.3E-13594676IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.8E-18594674No hitNo description
PfamPF005641.9E-14595674IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MEEIEKSQLP VNDDVVYEVY TSSEFKNYMG EPLSCSEERS NFHLMVFWSN NETESNFPHN  60
LIETSVKQKI KAALQRIETS QVILLQFWGL EKIEGRHFLT TSGQPFGLRY LYKGLCWYRK  120
HCQGYKYSVN NKGESSEQGT EKAHLFGPPA RVFQEKLPES STHVGYYTNE EFPMRDHAVR  180
CGVRTYLALP VFEPIGKNCV GVIELVTVWK GGYLTYEVEK VLNALEGVDL KCPKLYLQKA  240
RKVQAGKQSE RREIKRMLKI VRETHKLPFV RVWIPYEEMD ANDHVYDDYY YDDMLCFRDI  300
SKLQPLQKDQ GVVGKAFFSG ELCYCENITE FSIIEYPLVH YARWCGLTSS FAICLKNGDE  360
AYILELFLPP DNGDPKILLG SILSTMGQHF HNFKFASGQE LGHDSSVQVI KASSHKNVDY  420
FHICQIRESP FMPEVLCDEE RSNRQMEGNE SHREKEAISE CMVQNSVDNG QQQIMVQSDV  480
LNTDIQVISE KQCVSITRLQ KESRTRTKDS VNYDDLKQHF NKNLSDAAES LQVSRSTLKR  540
LCRKYGIRRW PSSKRKKTVN ESNCQPLNML PKKKKAITSA TTSTHANHVN SSSSITVKAT  600
YGEDMMKFKL YSSSRKDDLD RELAKRLQLP IGKFRIKYMD EDNDYIWIAC DDDLSDCFNN  660
AQSLGKNTIK MLVLPAAINY SLEL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1554574RKKTVNESNCQPLNMLPKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605049.10.0PREDICTED: protein NLP6-like isoform X2
TrEMBLM1AWJ60.0M1AWJ6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000319410.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.12e-83Nin-like family protein